NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010007

3300010007: Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #4 sample T4



Overview

Basic Information
IMG/M Taxon OID3300010007 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0120461 | Gp0151273 | Ga0133909
Sample NameMicrobial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #4 sample T4
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Maryland
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17714981
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1
Not Available2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBlack Band Disease Transitions
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationBelize: Carrie Bow Cay Field Station
CoordinatesLat. (o)16.80288Long. (o)-88.08213Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010974Metagenome / Metatranscriptome296Y
F013645Metagenome / Metatranscriptome269Y
F030664Metagenome / Metatranscriptome184Y
F039942Metagenome / Metatranscriptome162Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0133909_100037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2041Open in IMG/M
Ga0133909_101080Not Available631Open in IMG/M
Ga0133909_101203All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia606Open in IMG/M
Ga0133909_102000Not Available523Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0133909_100037Ga0133909_1000372F013645MKIEVNKIMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEKEEKPK*
Ga0133909_101080Ga0133909_1010801F039942SPGLENIPLFAGNRAEVSQNHDARKAVSATLSVLKLSGAIFRPISSKVSVQKVLLCPFNCKLRPSEVSLASPGIENIRQLPGNRAEVGQNYDARKAVSATLSVLK*
Ga0133909_101203Ga0133909_1012031F030664GLNDKEKKQNKTAEQADNISSRGFRHENENTAYFWINSALEASNRSQITFCILTNVLISISERFCPNFEQINISPAATAITVACILN*
Ga0133909_102000Ga0133909_1020001F010974MKQSKDLLHLPKTARNTRKITNKLMTVASAEINLQSKHDLICHVAKVKAATSAHSMADVIPFFSVFIIPFKSNALIKRKENIFYPQKRKQYP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.