NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010006

3300010006: Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #2 sample B2



Overview

Basic Information
IMG/M Taxon OID3300010006 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0120461 | Gp0151263 | Ga0133898
Sample NameMicrobial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #2 sample B2
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Maryland
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size19512071
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBlack Band Disease Transitions
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationBelize: Carrie Bow Cay Field Station
CoordinatesLat. (o)16.80288Long. (o)-88.08213Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003577Metagenome / Metatranscriptome478Y
F010974Metagenome / Metatranscriptome296Y
F012646Metagenome / Metatranscriptome278Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0133898_103115Not Available589Open in IMG/M
Ga0133898_103603Not Available524Open in IMG/M
Ga0133898_103742All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata510Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0133898_103115Ga0133898_1031151F010974MKEPKNLLHLPKTTRNTRKLANKLMTVASGEINFQSKHDLISHVAKVKAATLTHSMADVIPFFSVFINPFESNASIKPKENIFYPQQRKQYP*
Ga0133898_103603Ga0133898_1036031F003577LGYSFSLKVKWGYISGQKPESERSKSFAVFISLQTKAIRS*
Ga0133898_103742Ga0133898_1037421F012646KLGVNNEVNPGTKKAALKLMAGGPSKINPPNSHPSNPIHKVATAESRKSASSETQQAKPTAQKIEPKAPDKTPQHEINKTAVIVGVVGLSALLFMA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.