| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010006 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120461 | Gp0151263 | Ga0133898 |
| Sample Name | Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #2 sample B2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Maryland |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 19512071 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Black Band Disease Transitions |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Belize: Carrie Bow Cay Field Station | |||||||
| Coordinates | Lat. (o) | 16.80288 | Long. (o) | -88.08213 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003577 | Metagenome / Metatranscriptome | 478 | Y |
| F010974 | Metagenome / Metatranscriptome | 296 | Y |
| F012646 | Metagenome / Metatranscriptome | 278 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0133898_103115 | Not Available | 589 | Open in IMG/M |
| Ga0133898_103603 | Not Available | 524 | Open in IMG/M |
| Ga0133898_103742 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata | 510 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0133898_103115 | Ga0133898_1031151 | F010974 | MKEPKNLLHLPKTTRNTRKLANKLMTVASGEINFQSKHDLISHVAKVKAATLTHSMADVIPFFSVFINPFESNASIKPKENIFYPQQRKQYP* |
| Ga0133898_103603 | Ga0133898_1036031 | F003577 | LGYSFSLKVKWGYISGQKPESERSKSFAVFISLQTKAIRS* |
| Ga0133898_103742 | Ga0133898_1037421 | F012646 | KLGVNNEVNPGTKKAALKLMAGGPSKINPPNSHPSNPIHKVATAESRKSASSETQQAKPTAQKIEPKAPDKTPQHEINKTAVIVGVVGLSALLFMA* |
| ⦗Top⦘ |