NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009952

3300009952: Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 12



Overview

Basic Information
IMG/M Taxon OID3300009952 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0120337 | Gp0151216 | Ga0133743
Sample NameHuman saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 12
Sequencing StatusPermanent Draft
Sequencing CenterAutonomous University of Barcelona
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3163288
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity → Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal secretion

Location Information
LocationAlicante,Spain
CoordinatesLat. (o)38.3852246Long. (o)-0.5132249Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101360Metagenome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0133743_10002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes43028Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0133743_10002Ga0133743_100029F101360VSKENALRRAAIAAHVAKVASQEKKKALKELEEYMAPGDTSKPMIDGLQVGTVSVSAPQPRYQVVDEKALVAWLEWNKPDAVHKVPAPWFVAAAALDGFIKQTGEVPDGVEVVQGDPRISVRISTPQEEAIRELISTGDISLLEIEGGDA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.