| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009933 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120440 | Gp0149062 | Ga0131740 |
| Sample Name | Microbial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R15 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of New South Wales |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 104796940 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sponge Microbes In A High Co2 World |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Davies Reef, Great Barrier Reef, Australia | |||||||
| Coordinates | Lat. (o) | -18.833 | Long. (o) | 147.683 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028464 | Metagenome / Metatranscriptome | 191 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0131740_136711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 752 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0131740_136711 | Ga0131740_1367112 | F028464 | VGLGTDRRHPDFRHVDGSVMNARLYIDDRLIVHEQGMLDRSLLHHPEVLEAASAYGDPYQVLAPVSHDAHGSGTLW* |
| ⦗Top⦘ |