3300009885: Microbial communities of marine sponge Cymbastella coralliophila from Great Barrier Reef, Australia - CY13

Overview

Basic Information

• IMG/M Taxon OID: 3300009885
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0120440 | Gp0149039 | Ga0131722
• Sample Name: Microbial communities of marine sponge Cymbastella coralliophila from Great Barrier Reef, Australia - CY13
• Sequencing Status: Permanent Draft
• Sequencing Center: University of New South Wales
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 27616659
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Sponge Microbes In A High Co2 World
• Type: Host-Associated
• Taxonomy: Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: Davies Reef, Great Barrier Reef, Australia
• Coordinates
  • Lat. (^o): -18.833
  • Long. (^o): 147.683
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016734	Metagenome / Metatranscriptome	245	Y
F036473	Metagenome / Metatranscriptome	170	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0131722_102443	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1375

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0131722_102443	Ga0131722_1024432	F016734	MNEDKINKLGLTDSERDAIDHEPKRSLIDLDTYQQTDVLTLQGYQLRAVMDDIVLAQYVDLSDDDRCLNRNGVLIPLSQVQRTWRLARVILAGSGCKHTKRGDIVCFPDDKGVRVDNLRVKGYEDPLRHCLFLNEQRFFGICEEL*
Ga0131722_102443	Ga0131722_1024433	F036473	VIVSLIHLKGELLQKVCEVRFMRRRTKRGSSILRRMLCTNNEQLLNSIEGRTALNYRPTRGLLKYNPNQKNLLVTWDIMMQDYRQINCDAVDLITTLDADDTFWSYLSEHIAPMSAQDKINFHNT*