3300009867: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 4, 12m depth; RNA IDBA-UD

Overview

Basic Information

• IMG/M Taxon OID: 3300009867
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0116874 | Gp0151144 | Ga0132192
• Sample Name: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 4, 12m depth; RNA IDBA-UD
• Sequencing Status: Permanent Draft
• Sequencing Center: Marine Biological Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 32220970
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → unclassified Spirochaetales → Spirochaetales bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → meromictic pond → pond water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Falmouth, Massachusetts
• Coordinates
  • Lat. (^o): 41.548517
  • Long. (^o): -70.622961
  • Alt. (m): N/A
  • Depth (m): 12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018511	Metagenome / Metatranscriptome	234	N
F084270	Metagenome / Metatranscriptome	112	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0132192_105858	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → unclassified Spirochaetales → Spirochaetales bacterium	763

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0132192_105858	Ga0132192_1058581	F084270	MPRQTGQTNTQFPDGFRLEISTDGTTGSTWEEVGVLAGGATATLTWDDYYLDAGNYEGLVDKAKNPVFAIAPSAVWNWDVAVIAALFPGLFSTSAATTPAVGDDVEYAGTSNQVTLTRSKIRLTHYTVDASGGSETDGDIDWQFTLHNAKIDSGASFNFKGVNEDGLDEFTVSFTGKPDPASTYALFTYFKAD*
Ga0132192_113745	Ga0132192_1137451	F018511	TQVMATVDRTYRVLSIDPVDMDYLFYIYNNFVNHYEPERRNCPACRTKVVGKMRQIVNYWRDGNQ*