3300009557: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; RNA IDBA-UD

Overview

Basic Information

• IMG/M Taxon OID: 3300009557
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0116874 | Gp0147224 | Ga0130021
• Sample Name: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; RNA IDBA-UD
• Sequencing Status: Permanent Draft
• Sequencing Center: Marine Biological Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 17718468
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2
All Organisms → cellular organisms → Eukaryota → Cryptophyceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → meromictic pond → pond water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Siders Pond, Falmouth, Massachusetts
• Coordinates
  • Lat. (^o): 41.548517
  • Long. (^o): -70.622961
  • Alt. (m): N/A
  • Depth (m): 8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025879	Metagenome / Metatranscriptome	200	Y
F026478	Metagenome / Metatranscriptome	197	Y
F069988	Metagenome / Metatranscriptome	123	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0130021_101541	Not Available	1069
Ga0130021_103797	Not Available	700
Ga0130021_108268	All Organisms → cellular organisms → Eukaryota → Cryptophyceae	501

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0130021_101541	Ga0130021_1015412	F025879	YKGYPDFLKLMREFRIQRTDFDVWIPQLTGKSPESWIDNTKVPKHEYYTKLQYCKVGVQMRQSNYGWSVSGTDCMMNGTPMIFHDSLCYREIDPSGLFFKYKKDFFNLLNSFLDDDEFRIKHELRSIERAKELSSNEANMIKQLHKKLN*
Ga0130021_103797	Ga0130021_1037971	F069988	VIYLKNERWFELPKSKDIDEPKVKPKQRINPYAA*
Ga0130021_108268	Ga0130021_1082681	F026478	LPLLLALAFCVLLGAAAQKPKRKTVSITDPDVLKAKEFALKEIIKLTDSYRDMKVNKILKAETARSAFADGTNYFLKLELECVSICAAPLSPASTCRRGKYKGGNEVIVFEKDDGHYDGIAIDEFPQMDGEYHPCTPSYKGPEKCNPAEHRTPEQAALFADD