3300009535: Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov

Overview

Basic Information

• IMG/M Taxon OID: 3300009535
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118459 | Gp0139339 | Ga0127526
• Sample Name: Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Texas, Austin
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 265644161
• Sequencing Scaffolds: 7
• Novel Protein Genes: 7
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	5
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Calyophus Hartwegii → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: Tucson, AZ, USA
• Coordinates
  • Lat. (^o): 32.23184
  • Long. (^o): -110.950699
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y
F060091	Metagenome	133	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0127526_1003942	Not Available	1771
Ga0127526_1007566	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini	6302
Ga0127526_1008954	Not Available	1069
Ga0127526_1029689	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum	1305
Ga0127526_1060880	Not Available	1465
Ga0127526_1077605	Not Available	2844
Ga0127526_1089232	Not Available	1001

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0127526_1003942	Ga0127526_10039421	F029983	MSLYCTVGFKCRGCMDGVKFEFNNIIPLYKXNDSERKRS
Ga0127526_1007566	Ga0127526_10075664	F060091	MDELHDLNYKLDLSSESDSDEEMNELLLLYSLSKRNKSIWKSAYMKKRKSHGEFILTSEFSDKQFTNYFRLNRNQFNEVLSIVNDKIYLVGCNAQKPIDPEEKLAVFLR*
Ga0127526_1008954	Ga0127526_10089542	F029983	VGKWMSLXCTVDYKWVTLMDGFTFEFNDIISLYKQ
Ga0127526_1029689	Ga0127526_10296891	F029983	LCCTVGYKWVTVMDCVKFEFNXXISLYTKNDSER*
Ga0127526_1060880	Ga0127526_10608801	F029983	MSLCCTVGYKWITDHCIMDCIRFEFNDIISLYRYTKNDSERRRFV
Ga0127526_1077605	Ga0127526_10776051	F029983	MSLCYTXXYKWVTVMDFVKFELKDIISLYKXNDSERKR
Ga0127526_1089232	Ga0127526_10892321	F029983	MSLCCTVGYKWVTVMDDVKFESNXXISLYTKKILSENG