3300009531: Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov

Overview

Basic Information

• IMG/M Taxon OID: 3300009531
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118459 | Gp0139335 | Ga0127525
• Sample Name: Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Texas, Austin
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 206796682
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Cabbage → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: Tucson, AZ, USA
• Coordinates
  • Lat. (^o): 32.23184
  • Long. (^o): -110.950699
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0127525_120133	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	3571

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0127525_120133	Ga0127525_1201332	F029983	MSLCCTVAYEWITVMDVIKFEFNDIITLYMKNDSELSQLSV*