3300009493: Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov

Overview

Basic Information

• IMG/M Taxon OID: 3300009493
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118459 | Gp0136421 | Ga0127654
• Sample Name: Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Texas, Austin
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 191563800
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Witch-Hazel → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: USA: West Haven, Connecticut
• Coordinates
  • Lat. (^o): 41.257945
  • Long. (^o): -72.989398
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0127654_153383	Not Available	2070
Ga0127654_166991	Not Available	2268

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0127654_153383	Ga0127654_1533831	F029983	MSLCCTVDYKWVAVMEGVKFEFNDISFYKKNDSER
Ga0127654_166991	Ga0127654_1669911	F029983	VSLYCTVGYKWETVMDGVIKFEFNDIISLYKINDCERRRSV