x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300009482
3300009482: Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov
Overview
Basic Information
IMG/M Taxon OID 3300009482 Open in IMG/M GOLD Reference Gs0118459 | Gp0138847 | Ga0127527 Sample Name Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov Sequencing Status Permanent Draft Sequencing Center University of Texas, Austin Published? N Use Policy Open
Dataset Contents
Total Genome Size 202640506 Sequencing Scaffolds 3 Novel Protein Genes 3 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera 3
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa Type Host-Associated Taxonomy Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Chrysanthemum → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal corpus
Location Information
Location New Haven, CT, USA Coordinates Lat. (o ) 41.257945 Long. (o ) -72.989398 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F060091 Metagenome 133 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0127527_108790 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera 3429 Open in IMG/M Ga0127527_119327 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera 6102 Open in IMG/M Ga0127527_140695 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera 4105 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0127527_108790 Ga0127527_1087901 F060091 MMAHELFKLDLSSESDSDEEFDELVLYSLIKRKKSRNSDFMKKRKSHGEFVLTKELSEKQFTNYFRLNRCQFHEVLHIIKDTIFSEGCNAQRPIDPEEKLAVFLR* Ga0127527_119327 Ga0127527_1193273 F060091 MDEQHDLNYKLDLSSESDSDEEMNELLLLYSLSKRNKSIWKSEYMKKRKSHGEFILTSEFSDKQFTNYFRLNRNQFNEVLSIVNDKIYSVGCNAQKPIDPEEKLAVFLR* Ga0127527_140695 Ga0127527_1406951 F060091 MSDSMMAENLINLSSESDSDDEIDELILLYSLSKEKKTWKSNFMKKRQSHGEFNLSSEFSDKQFLNYFRLDRNQFNEVLNLIRDTIYSFGCNAQKPIDPEEKLAVFLR*
