3300009468: Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov

Overview

Basic Information

• IMG/M Taxon OID: 3300009468
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118459 | Gp0139336 | Ga0127530
• Sample Name: Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Texas, Austin
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 199344178
• Sequencing Scaffolds: 5
• Novel Protein Genes: 5
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	4
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Rosa → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: Tucson, AZ, USA
• Coordinates
  • Lat. (^o): 32.23184
  • Long. (^o): -110.950699
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0127530_104952	Not Available	1871
Ga0127530_107241	Not Available	2168
Ga0127530_141853	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha	1236
Ga0127530_145771	Not Available	1222
Ga0127530_167013	Not Available	1373

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0127530_104952	Ga0127530_1049521	F029983	MSLFCTVGYKVGQCITDCIKFELNDIISLYRKNDSE
Ga0127530_107241	Ga0127530_1072411	F029983	MSIFCTVGYKWVTVMNGVKFELNDIISLNTKNDSERR
Ga0127530_141853	Ga0127530_1418531	F029983	VSICCTIGYKWVTIIDVVKFEFNDKKSLYKKNASKRRLSV
Ga0127530_145771	Ga0127530_1457712	F029983	VSLCCIVGYKLVTVMNGVQFEFNDKISLYKKNGSERR
Ga0127530_167013	Ga0127530_1670131	F029983	VLXXCTVGYKRGTVMDGVIFKFNDIXSLYKKNDSERRQ