x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300009463
3300009463: Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov
Overview
Basic Information
IMG/M Taxon OID 3300009463 Open in IMG/M GOLD Reference Gs0118459 | Gp0136466 | Ga0127644 Sample Name Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov Sequencing Status Permanent Draft Sequencing Center University of Texas, Austin Published? N Use Policy Open
Dataset Contents
Total Genome Size 306114060 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera 1 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa Type Host-Associated Taxonomy Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Fava Bean → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal corpus
Location Information
Location Tucson, AZ, USA Coordinates Lat. (o ) 32.23184 Long. (o ) -110.950699 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F060091 Metagenome 133 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0127644_117424 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera 3587 Open in IMG/M Ga0127644_137895 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini 1930 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0127644_117424 Ga0127644_1174243 F060091 HRPLSVMSMSNIIAKNLISLSSESDSDDEFDELLLLYSLTKRKKLWKSNFIKKRKSHGEFNLSSEFSDKQFSNYFRLNRNQFDEVLHMIRDTIYSFGCNAQKPINPEEKLAVFLR* Ga0127644_137895 Ga0127644_1378952 F060091 MDKLHELNYKLDLSSESDSDEEINELLLLYSLSKRNKSIWKSAHMKKRKSHGEFILTSEFSDKQFTNYFRLNRNQFNEVLSIVNDKIYSVGCNAQKPIDPEEKLAVFLR*
