NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009454

3300009454: Microbial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374 seqcov



Overview

Basic Information
IMG/M Taxon OID3300009454 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118459 | Gp0136465 | Ga0127519
Sample NameMicrobial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374 seqcov
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Texas, Austin
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size111290478
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHost-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
TypeHost-Associated
TaxonomyHost-Associated → Insecta → Unclassified → Unclassified → Unclassified → Sagebrush → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationOnefour, Alberta, CA
CoordinatesLat. (o)49.115537Long. (o)-110.468757Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029983Metagenome186Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0127519_121564All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2369Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0127519_121564Ga0127519_1215641F029983MSLCCTVDYKWVTVMDGIKYEFNDIILLHKNHMI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.