3300009452: Marine sponge C. singaporensis. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', co31is 06june2016

Overview

Basic Information

• IMG/M Taxon OID: 3300009452
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117787 | Gp0124749 | Ga0128062
• Sample Name: Marine sponge C. singaporensis. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', co31is 06june2016
• Sequencing Status: Finished
• Sequencing Center: University of New South Wales
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 12073252
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps
• Type: Host-Associated
• Taxonomy: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Upa-Upasina
• Coordinates
  • Lat. (^o): -9.8241
  • Long. (^o): 150.825833
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001905	Metagenome	619	Y
F090511	Metagenome	108	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0128062_101373	All Organisms → Viruses → Predicted Viral	1004
Ga0128062_102384	Not Available	749

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0128062_101373	Ga0128062_1013731	F090511	MLYPFKRKILQRMGLNHVAYHGNKNCNEDWLNGYFQAKKDLEMQLNQIRITTDDLD*
Ga0128062_102384	Ga0128062_1023842	F001905	MFPFYIRMAILLCVGAFAPIIIHHIIMKLWDVSILRAAEYTFIACIPIAVWMAEKINERWNDEDQ*