NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009317

3300009317: Microbial communities of water from the North Atlantic ocean - ACM33



Overview

Basic Information
IMG/M Taxon OID3300009317 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117984 | Gp0126417 | Ga0103828
Sample NameMicrobial communities of water from the North Atlantic ocean - ACM33
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Georgia
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7932201
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Sednavirus → Synechococcus virus SRIP21

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysurface water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005495Metagenome / Metatranscriptome399Y
F047990Metagenome / Metatranscriptome149N
F093788Metagenome / Metatranscriptome106N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103828_100191Not Available1096Open in IMG/M
Ga0103828_100498Not Available809Open in IMG/M
Ga0103828_101172All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Sednavirus → Synechococcus virus SRIP2612Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103828_100191Ga0103828_1001911F005495MLKWNGGSNTPNLNMKKYTILKDTVAGGQRVHAGDIVELPEHEGHALCGYGKAEVHVDKPKAEKQDRSVGLKTSKT
Ga0103828_100498Ga0103828_1004981F047990MTTIVGSGDYTVEIDTGAPVQAFRLDDATRGVLDGTTFVLDGLTDFADVTSGTVAMRLNRGRKDTTDSFQPGLFEFTLNDTAAGGVFNPFASDSPYYDPDNDQPGIA
Ga0103828_101172Ga0103828_1011721F093788NLSITTMTEFNPRSYILTQLAYAEEQLMIADDMTSKLTWGNRCDALEAALADLEAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.