3300008985: Combined Assembly of De NOVO T8 (BES) Tyne Sediment Benzoate Gp0125117, Gp0125118, Gp0125119

Overview

Basic Information

• IMG/M Taxon OID: 3300008985
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117429 | Gp0125117 | Ga0116017
• Sample Name: Combined Assembly of De NOVO T8 (BES) Tyne Sediment Benzoate Gp0125117, Gp0125118, Gp0125119
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 210188680
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Sediment (non-saline)

Location Information

• Location: UK (Newcastle upon Tyne)
• Coordinates
  • Lat. (^o): 54.971158
  • Long. (^o): -1.703654
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105440	Metagenome / Metatranscriptome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0116017_1034849	Not Available	594

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0116017_1034849	Ga0116017_10348492	F105440	MQSAEAKDSSINYRRLKADRSISLLYNPATRDGKFSAKLTARAGLVDSYYEAFTQSEYSESLAENNAKLQKYGWPDYENEGI*