3300008926: Microbial communities from freshwater in the western basin of Lake Erie, USA - 973-2

Overview

Basic Information

• IMG/M Taxon OID: 3300008926
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117964 | Gp0126293 | Ga0103704
• Sample Name: Microbial communities from freshwater in the western basin of Lake Erie, USA - 973-2
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Tennessee
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 7010967
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater lake → lake water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: western basin of Lake Erie, USA
• Coordinates
  • Lat. (^o): 41.79
  • Long. (^o): -83.33
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030134	Metagenome / Metatranscriptome	186	Y
F060948	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0103704_101482	Not Available	1139
Ga0103704_101880	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata	902

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103704_101482	Ga0103704_1014821	F030134	ITPHEIIVEVNSFRTKTTKLKKDKIQPVLRRFKLRSCNFLLVEQTNNLCCYNIDDKIIQHRGSR*
Ga0103704_101880	Ga0103704_1018801	F060948	LCCTHLSDVTLTIAKNAFRTFFLFIGKVEWLLFTDGMLNSDTVIRLAYAHYVVAFYLFFLGLSHGIDMHYD*