| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008885 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118520 | Gp0137009 | Ga0115910 |
| Sample Name | Microbial communities associated with green microalga Chlorella saccharophila, Germany - (MZCH: 10155) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | HPI Heinrich-Pette-Institut |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 174773623 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Associated With Green Microalga Chlorella Saccharophila, Germany - (Mzch: 10155) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Chlorella Sacherophilia (Mzch 10155) Associated → Microbial Communities Associated With Green Microalga Chlorella Saccharophila, Germany - (Mzch: 10155) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | 53.560155 | Long. (o) | 9.859606 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029122 | Metagenome / Metatranscriptome | 189 | N |
| F097276 | Metagenome / Metatranscriptome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0115910_159371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0115910_155090 | Ga0115910_1550901 | F097276 | MIKARLAIVGASILSVGAAPADMLPLKQGIFVPVGSACKGASNAEMVNYWGGKSSIGVAQATCTIKKLVKAGTTYTVTDLCKDLQSGYAIDGEPRVLKIASPTQFSMDGTSYRYCGPKPQW* |
| Ga0115910_159371 | Ga0115910_1593711 | F029122 | MLIRPAISDTDPIRHRRPTPDGQFSGNIIDEAMRPFARRG |
| ⦗Top⦘ |