| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008857 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117986 | Gp0126492 | Ga0103903 |
| Sample Name | Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_4079 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Massachusetts Institute of Technology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2320595 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → surface water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000075 | Metagenome / Metatranscriptome | 2622 | Y |
| F040635 | Metagenome / Metatranscriptome | 161 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103903_10269 | All Organisms → cellular organisms → Eukaryota → Sar | 590 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103903_10269 | Ga0103903_102691 | F040635 | VRHEDIPDMSNPKTTKAVLEGDKLIMEVLKGGYNVHPVPP |
| Ga0103903_10370 | Ga0103903_103701 | F000075 | ATVAASRYDSMNEDELLVSLQSNLSSALSSEARGDGDAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK |
| ⦗Top⦘ |