NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008856

3300008856: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_3062



Overview

Basic Information
IMG/M Taxon OID3300008856 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117986 | Gp0126491 | Ga0103902
Sample NameMicrobial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_3062
Sequencing StatusPermanent Draft
Sequencing CenterMassachusetts Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7328224
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysurface water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000155Metagenome / Metatranscriptome1877Y
F027191Metagenome / Metatranscriptome195Y
F090440Metagenome / Metatranscriptome108N
F090441Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103902_100262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae831Open in IMG/M
Ga0103902_100809Not Available594Open in IMG/M
Ga0103902_100961Not Available560Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103902_100262Ga0103902_1002621F027191PIQRKERKERKKNEIEKPLLQSINLVKVVRFLISPKKKRARIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103902_100809Ga0103902_1008091F090440EISGLKLATDLRPKRIYHCRVTDVGEDYVLRIIILKSIGG*
Ga0103902_100961Ga0103902_1009611F090441LEFFFFFLGEVWELATLSFPDLLALGALITRRVIVGCQFPDAASYRKNDCNMFRSRSGTRFQRNH*
Ga0103902_101119Ga0103902_1011191F000155ATLIAVVSANQFESMNEDDLLVSLESNLNSALSSEARGDADAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.