3300008839: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2006

Overview

Basic Information

• IMG/M Taxon OID: 3300008839
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117986 | Gp0126476 | Ga0103887
• Sample Name: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2006
• Sequencing Status: Permanent Draft
• Sequencing Center: Massachusetts Institute of Technology
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1866780
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → surface water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: North Pacific Ocean
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090440	Metagenome / Metatranscriptome	108	N
F090441	Metatranscriptome	108	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0103887_10165	Not Available	609
Ga0103887_10228	Not Available	547

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103887_10165	Ga0103887_101651	F090440	KFRYPPDLKLATDLRLKRIYHCRVTDVGEDYVLRIIILKSIGG*
Ga0103887_10228	Ga0103887_102281	F090441	WSFFFFGEVWELATLSFPDSLALGALITRRVIVGCQFPDAASYRKNDCDMFRSHSGT*