NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008778

3300008778: Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 300m_0.2-1.6micron



Overview

Basic Information
IMG/M Taxon OID3300008778 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117950 | Gp0126182 | Ga0103593
Sample NameMicrobial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 300m_0.2-1.6micron
Sequencing StatusPermanent Draft
Sequencing CenterGeorgia Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1579973
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine oxygen minimum zonesea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)18.9Long. (o)-104.5Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006509Metagenome / Metatranscriptome371Y
F030135Metagenome / Metatranscriptome186Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103593_10443Not Available724Open in IMG/M
Ga0103593_10523Not Available674Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103593_10443Ga0103593_104431F030135ATLSSFTDIWHSTYVGCQFPDAILPGTEAFDLVAGPLS*
Ga0103593_10523Ga0103593_105231F006509PGNVITAITNLVSNAGVVATDTAGVGTARQILGACEYGEDKGIFGFGWTGSYVSMTNLVSNVGVVATDTAGVGGTRDGPAACEYGEDKGIFGFGNTGSVTGVTNLVSNAGVVASDVTAVGTARKVVAACEYGGDKGIFGFGNTPTYVSTTNLVSNAGVVASDVTGVGTDRRALAACSYGFDKGIFGYGNAAKSMTNLVSNTGVVSSDVAGVGTGRQAPAACEYG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.