3300008752: Microbial communities from the gut of humanized mice in USA - E13.FECAL.14dpc

Overview

Basic Information

• IMG/M Taxon OID: 3300008752
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117949 | Gp0126133 | Ga0103544
• Sample Name: Microbial communities from the gut of humanized mice in USA - E13.FECAL.14dpc
• Sequencing Status: Permanent Draft
• Sequencing Center: CCME-COLORADO
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 13913824
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities From The Gut Of Humanized Mice In Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From The Gut Of Humanized Mice In Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: USA
• Coordinates
  • Lat. (^o): 38.65
  • Long. (^o): -90.26
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0103544_103995	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	502

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103544_103995	Ga0103544_1039951	F047125	DLLDVVLLLMVLGVMLSGFWAADALDHMRKEILQQEGKRRGWWS*