| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008720 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053328 | Ga0115616 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159753524 replicate 1 reassembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 27464340 |
| Sequencing Scaffolds | 7 |
| Novel Protein Genes | 7 |
| Associated Families | 7 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78 | 1 |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum | 1 |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | National Institutes of Health, USA | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006329 | Metagenome / Metatranscriptome | 376 | Y |
| F027342 | Metagenome | 195 | Y |
| F032472 | Metagenome / Metatranscriptome | 180 | Y |
| F059631 | Metagenome | 133 | Y |
| F063778 | Metagenome | 129 | Y |
| F076912 | Metagenome | 117 | Y |
| F097527 | Metagenome | 104 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0115616_102159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 2041 | Open in IMG/M |
| Ga0115616_103002 | Not Available | 1606 | Open in IMG/M |
| Ga0115616_105489 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii | 1010 | Open in IMG/M |
| Ga0115616_106183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces | 924 | Open in IMG/M |
| Ga0115616_106749 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78 | 860 | Open in IMG/M |
| Ga0115616_110148 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum | 614 | Open in IMG/M |
| Ga0115616_111922 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae | 531 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0115616_102159 | Ga0115616_1021595 | F097527 | MIYFKMEKIGNSTKTEKKKTRSENLVIITIPAAGVEPARPCGHWIL |
| Ga0115616_103002 | Ga0115616_1030022 | F076912 | LGKSALLSNGKGSNADKVQDSETSLLVSKKADKNYLDDSEGTQKSCLDVVFELLATTAGTSSSNSLPESVRFLESQLQVERHRSDVMRQEAEGLRKSLQNSDAYFLVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS* |
| Ga0115616_105489 | Ga0115616_1054892 | F006329 | ERLNLVEEENNYLKEKIKNKEEKMILELHVADVVDDHKIKMDAMRLKIRKIRKYAIDTEAWYHYAVGSIVTLVAIMIAFVFALKCFT* |
| Ga0115616_106183 | Ga0115616_1061831 | F063778 | SEGTKQQLLQQLQNALGLVADADTSAHDVAAITQSAADGHQLTEVMLQQMTAIEAYLKNCQTSINDAIDNIEAIPLDPPPED* |
| Ga0115616_106749 | Ga0115616_1067491 | F032472 | MAPPIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPQPSAPHCHDGHDLALQPDSTLEAALESAPIFNSKPAAQIEDGWLDTASGATISTAIEPNTIPVPCKARDSEVLDSIPDSEYSAPLPIEPDWALIMEFTTADIFQHSPF |
| Ga0115616_110148 | Ga0115616_1101481 | F027342 | LESKAQAAELATALETANFAKAEAQKALQELEEMRKIAAGKAFFMQSKHVSFNCLLLTRIRSSPGAFADLPHSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHSVPLSDQLKQLVELHKAAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALAHAKVHWGKLDAEKLVKDGRLLVITGCGLAACS |
| Ga0115616_111922 | Ga0115616_1119221 | F059631 | LWLKTFSVKPKVVKGSQAECGGAMVGRMSHVTCLEGTFVETIKGWQSGWFYITEPRDPEWAVAPEFRSGFPTQLTSWKEKGLLWGSSEELTGLQACIQKLVNKKLKLVNIVQVMLIRRILPCQHRACNLWEFDPAKHQTLRELFGSSHKDIWKVLFKSGKSWPDSAEDRGYQLSRPA |
| ⦗Top⦘ |