NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008714

3300008714: Human attached/keratinized gingiva microbial communities from NIH, USA - visit 1, subject 763577454 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008714 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053320 | Ga0115608
Sample NameHuman attached/keratinized gingiva microbial communities from NIH, USA - visit 1, subject 763577454 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size46456245
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2791
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphovirus contig891

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051213Metagenome144N
F059076Metagenome134N
F095632Metagenome105N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0115608_100045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae70423Open in IMG/M
Ga0115608_100228All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27924164Open in IMG/M
Ga0115608_112692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphovirus contig89558Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0115608_100045Ga0115608_10004528F059076MTNRILLLGLLLGGASINAQNINETNAAGKTGQKVGINTTIPTRTLTIKNAAANDGKPLLRLVDAPIYSKNVGSAMDADLGGNTATATNYTDYRPLMVDKVGDVYRGLPINNMSVLTLTISNVKGDWISEFDTGINYNKYAVAIMSYSFILPPYGPGNAVMLRGSFNTPNVIHGNGKHSVTTTPAFVILKKTGENWGIHADYPNLGPHEFTTGSTDLGPEVNGTWVITLLVGKKDAVNFTELRFSQDGKTTGQGTKDNAYKVGLENFLKKLE*
Ga0115608_100228Ga0115608_10022814F051213MKASKFLWAVVIALTFVLTSCDPFSKNEPIVEGDVDKYFDSNAQHKSFRVLTAEGKPYNHKVDWHIVGIMVPYSDTYLTKKVDTLSNGDFRISYDWVTFTVKENKSIIDVEVQKNETGKERSVTFRPSNSYKQAYLPKIRVTQRAN*
Ga0115608_100228Ga0115608_10022815F051213MKASKFLWAVVMALTFVLTSCDPFSQNEPTIEGDHYKYFDSSAQRQSFRVVNGSGKQYNHKVDWHIIGIQEENSDTYLTKKVDTLSNGDFRISYDWVTFTVKENKSIIDVEVQKNETGKDRSVFFATRNSYKQAYLPNMIVTQRAK*
Ga0115608_112692Ga0115608_1126921F095632CYKETTGYKVVSLVASTSASITAGAVVGALCPPAGVVLTAIYGVGSSVLGTYVGDKAGRQYAETLAETIDSVKTPQTN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.