3300008702: Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-06-46

Overview

Basic Information

• IMG/M Taxon OID: 3300008702
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117952 | Gp0126203 | Ga0103614
• Sample Name: Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-06-46
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Michigan
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 32147388
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Atlantic Ocean
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000344	Metagenome / Metatranscriptome	1257	Y
F076161	Metagenome / Metatranscriptome	118	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0103614_1005141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei	791
Ga0103614_1008697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1	554

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103614_1005141	Ga0103614_10051411	F000344	MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKKKKKKTP
Ga0103614_1008697	Ga0103614_10086971	F076161	LKSINFSSRYPKTGFRAFAEKPVVKSLLLPQFGGQKMPPQGASIPNRLTAWTVPQIAADPKERSNLLSSPTNPDAPTGKPV*