3300008671: Planktonic microbial communities from coastal waters of California, USA - Canon-54

Overview

Basic Information

• IMG/M Taxon OID: 3300008671
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117987 | Gp0126534 | Ga0103945
• Sample Name: Planktonic microbial communities from coastal waters of California, USA - Canon-54
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Hawaii
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1801972
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Planktonic Microbial Communities From Coastal Waters Of California, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → coastal water body → coastal sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Pacific Ocean
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030104	Metagenome / Metatranscriptome	186	Y
F090440	Metagenome / Metatranscriptome	108	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0103945_11467	Not Available	533
Ga0103945_11500	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium	528

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103945_11467	Ga0103945_114672	F090440	ASLGGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG*
Ga0103945_11500	Ga0103945_115001	F030104	MFSFIIFYLCYKHSIHYFAFLAASKTETRSVKFVANQFFADFLDTFSLMLRFYILLFRMNVYDNLDDFFDSYYIFVGDFDDDEYLNELFLSIHGTILFTLDNNDDRSFLLEDENDFSNDLFYTYFVLRG