NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008670

3300008670: Planktonic microbial communities from coastal waters of California, USA - Canon-56



Overview

Basic Information
IMG/M Taxon OID3300008670 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117987 | Gp0126535 | Ga0103946
Sample NamePlanktonic microbial communities from coastal waters of California, USA - Canon-56
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Hawaii
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1581762
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePlanktonic Microbial Communities From Coastal Waters Of California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal water bodycoastal sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003081Metagenome / Metatranscriptome508Y
F023489Metagenome / Metatranscriptome210Y
F037503Metagenome / Metatranscriptome168Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103946_10038All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1604Open in IMG/M
Ga0103946_10085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1292Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103946_10038Ga0103946_100381F037503MYLGAASRLSFIEVELLIGLGGFTAYQPLTNSECYEIYSRVRAWVIRSMSYRAEAMGLKNR*
Ga0103946_10085Ga0103946_100852F003081MFNDTRFGAEVFYMHVRGVDTLMVLSYMHIMKKIYLKNYVTSESDG*
Ga0103946_10829Ga0103946_108291F023489RCDCGANATKIVSATRHILDGASGDFPGRHMKWVREHKYEGQTSKES*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.