NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008590

3300008590: Microbial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Powermax_2a



Overview

Basic Information
IMG/M Taxon OID3300008590 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117956 | Gp0126232 | Ga0103643
Sample NameMicrobial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Powermax_2a
Sequencing StatusPermanent Draft
Sequencing CenterAuburn University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6620593
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomerhizospheresoil
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationOhio, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001679Metagenome / Metatranscriptome653Y
F005095Metagenome / Metatranscriptome412Y
F010686Metagenome / Metatranscriptome300Y
F052605Metagenome / Metatranscriptome142Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103643_100364Not Available626Open in IMG/M
Ga0103643_100633All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis566Open in IMG/M
Ga0103643_100704Not Available553Open in IMG/M
Ga0103643_100839Not Available528Open in IMG/M
Ga0103643_100990All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium505Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103643_100364Ga0103643_1003641F005095KQWYQRRVLGEYINRPLRGHTVKERTMAENAAIWKLHLIYRLSHIPERFDADVRGKVRALEGVSEVDVAPSHDASTRLTFSTPYAHAVIAAVAAKQCLQETIDAHNATGWWWQRKVQLIDEPAVRKVA*
Ga0103643_100633Ga0103643_1006331F010686AVVSTQSTWGGQATKGVWGMPRRQEAKKGVEDCDKPGGLVKRELIPGSLNQHVVNP*
Ga0103643_100704Ga0103643_1007041F052605IERTKRAAESKMEVARFKIIPGDWGKVGSGWLPRLLQTAPQGATEAEFTSSSGGVRTPSNANEGLGSKQRSETAAS*
Ga0103643_100839Ga0103643_1008392F010686QCGQATKGVWGMSWRQEAKKGVEDCDKPGGMVKRVLIPGSLNERVLNS*
Ga0103643_100990Ga0103643_1009902F001679MSRRQQAKKGVKDCEKPGGVVNQALIPGYPNGRQLNP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.