3300008578: Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Powermax_1a

Overview

Basic Information

• IMG/M Taxon OID: 3300008578
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117956 | Gp0126238 | Ga0103649
• Sample Name: Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Powermax_1a
• Sequencing Status: Permanent Draft
• Sequencing Center: Auburn University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 7133552
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → rhizosphere → soil
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: Ohio, USA
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001679	Metagenome / Metatranscriptome	653	Y
F046210	Metagenome / Metatranscriptome	151	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0103649_100182	Not Available	703
Ga0103649_100232	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	664

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103649_100182	Ga0103649_1001821	F046210	SSGINAEKGFRRTLFEPELVDPNLEINFVNDAEAALKSCNVNS*
Ga0103649_100232	Ga0103649_1002322	F001679	MWGMSRRQVAMKGVEGCDKPGGAVKRALIPGSLNYHGLNT*