NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008569

3300008569: Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-MB-F-N



Overview

Basic Information
IMG/M Taxon OID3300008569 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117973 | Gp0126368 | Ga0103779
Sample NameMicrobial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-MB-F-N
Sequencing StatusPermanent Draft
Sequencing CenterCentre National de la Recherche Scientifique (CNRS)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12098537
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11
Not Available2
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Microbial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakemicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Surface (non-saline)

Location Information
LocationChamps-sur-Marne, France
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034926Metagenome / Metatranscriptome173N
F043238Metagenome / Metatranscriptome156Y
F082866Metagenome / Metatranscriptome113Y
F100333Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103779_100649All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11494Open in IMG/M
Ga0103779_101930Not Available798Open in IMG/M
Ga0103779_103003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
Ga0103779_104083Not Available503Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103779_100649Ga0103779_1006491F082866MHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDADVNARF*
Ga0103779_101930Ga0103779_1019301F043238MKTIAQTLRELKTVDLSESMLKDIELMEQINLRHAYHDALIRVPFEEWYESNFRK*
Ga0103779_103003Ga0103779_1030032F034926RWEVSTTEGESVMGYIEVYNIDKDGEWTDLDDIPMITVINCQLCNEPTEAHDIIIPAVIKDGILTAGTWQCRKCKAVNG*
Ga0103779_104083Ga0103779_1040831F100333QIGKMVYFTYKKLNICTVALLATVFAVLIAAMSVNWYQYKVEFSYPLVTASDSSLASSLYNYTETTFDMYGQTVNTQGANTKIVRTVQQTYAQLGASNVNEQFKIQQAFVLIALLTAGLLFVAHTLYFFDGFRNKILFFVGITALRTILVIALLVVVASEIIAFLAF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.