| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008564 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117987 | Gp0126519 | Ga0103930 |
| Sample Name | Planktonic microbial communities from coastal waters of California, USA - Canon-33 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hawaii |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 612292 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Planktonic Microbial Communities From Coastal Waters Of California, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → coastal water body → coastal sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027881 | Metagenome / Metatranscriptome | 193 | Y |
| F090440 | Metagenome / Metatranscriptome | 108 | N |
| F090442 | Metagenome / Metatranscriptome | 108 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103930_1105 | Not Available | 914 | Open in IMG/M |
| Ga0103930_1501 | Not Available | 536 | Open in IMG/M |
| Ga0103930_1513 | Not Available | 531 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103930_1105 | Ga0103930_11051 | F027881 | ERVRGVLTHANCTKIKFNLSSVRVSNSLMTFIKFV* |
| Ga0103930_1501 | Ga0103930_15011 | F090442 | ALYESGKSGIRRGIPARPKKCIGKKHKLTPMKVVQK* |
| Ga0103930_1513 | Ga0103930_15131 | F090440 | TSLGGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| ⦗Top⦘ |