NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008564

3300008564: Planktonic microbial communities from coastal waters of California, USA - Canon-33



Overview

Basic Information
IMG/M Taxon OID3300008564 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117987 | Gp0126519 | Ga0103930
Sample NamePlanktonic microbial communities from coastal waters of California, USA - Canon-33
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Hawaii
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size612292
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePlanktonic Microbial Communities From Coastal Waters Of California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal water bodycoastal sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027881Metagenome / Metatranscriptome193Y
F090440Metagenome / Metatranscriptome108N
F090442Metagenome / Metatranscriptome108Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103930_1105Not Available914Open in IMG/M
Ga0103930_1501Not Available536Open in IMG/M
Ga0103930_1513Not Available531Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103930_1105Ga0103930_11051F027881ERVRGVLTHANCTKIKFNLSSVRVSNSLMTFIKFV*
Ga0103930_1501Ga0103930_15011F090442ALYESGKSGIRRGIPARPKKCIGKKHKLTPMKVVQK*
Ga0103930_1513Ga0103930_15131F090440TSLGGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.