Basic Information | |
---|---|
IMG/M Taxon OID | 3300008562 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117987 | Gp0126531 | Ga0103942 |
Sample Name | Planktonic microbial communities from coastal waters of California, USA - Canon-49 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Hawaii |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 1173449 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Planktonic Microbial Communities From Coastal Waters Of California, Usa |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → coastal water body → coastal sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Pacific Ocean | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000155 | Metagenome / Metatranscriptome | 1877 | Y |
F090440 | Metagenome / Metatranscriptome | 108 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0103942_10861 | Not Available | 563 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0103942_10861 | Ga0103942_108612 | F090440 | SLGGNEISGLKLATDLRLKRIYHCRITDVGEDYDLRIIIRKSIGG* |
Ga0103942_10925 | Ga0103942_109252 | F000155 | ASAAAVNFETMNEDELLAQLSTTVSSAQRSEARGDGDAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQP* |
⦗Top⦘ |