NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008505

3300008505: Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764224817 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008505 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052921 | Ga0111014
Sample NameHuman supragingival plaque microbial communities from NIH, USA - visit 2, subject 764224817 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size88914304
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cardiobacteriales → Cardiobacteriaceae → Cardiobacterium → unclassified Cardiobacterium → Cardiobacterium sp.1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga → Capnocytophaga sputigena1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040685Metagenome161N
F085821Metagenome111N
F089056Metagenome109N
F097526Metagenome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0111014_100036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae67915Open in IMG/M
Ga0111014_100891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae9186Open in IMG/M
Ga0111014_105734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cardiobacteriales → Cardiobacteriaceae → Cardiobacterium → unclassified Cardiobacterium → Cardiobacterium sp.2619Open in IMG/M
Ga0111014_120796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga → Capnocytophaga sputigena847Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0111014_100036Ga0111014_10003645F089056MIFYRIVNLINSKFNPLIIKKMNVFCKIILPLLCIISCSKRKEADNTKTLEKNHTFSLWNNDSLGCKHERTIEMGEELYNTFKKSNKNDSVLLKEYLGTPNRRFKDKEEIVFMYYINSCCDNGQLLEECDVSFIAITFTNKNEILFRKGIQ*
Ga0111014_100891Ga0111014_1008912F040685MKKLLFKLFFALAFASIPLHGQEKIQQVEFSSFGGRALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDRKVWYDLLQIIAEEFGKKGIYE*
Ga0111014_105734Ga0111014_1057345F097526MTTNDTKAITIYTQDDYRQLCERLDDDTVAALLHAHIRAFAADGNRQRLNRLTEAMRIAGEMEKAGRNEHPDPAEQKRRARWDSNLAGLQQQARMAHCEIVNADNAAVSQLTQQCEKNGSRDTAIPLPRDDYGFAAAVRDFPLSETQTALLWRMALLTIAEIADIAPELAAIYLNGTGGEHLGRALVEKTVYPVTVVSNLAWLLHEQYKSGQLQRDLRHTAAASGNGEILAMLEDCQKILEQKNL*
Ga0111014_120796Ga0111014_1207962F085821MSNIFEQLAPLVETKKQQTTVAKFIEKGFKFTRQPDVQKFTFLVYDFFIAGNMPAVQLCIDYLVAQGYPTAENKKQFLNWIFMEPVYYLKYFISDASTQKKLHNDLLNLWYESSKRQLLEQDKGKHDEAYIDAWNEANVNKTLSTIRSGETIASRKEDVVELAESLNDEYELNISLLDEYCRALLCTAETTESQQELVAEIQSHIALLKDLYKKVNKIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.