NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008488

3300008488: Wastewater microbial communities from the hospital sewers in Singapore - Hospital 1



Overview

Basic Information
IMG/M Taxon OID3300008488 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118183 | Gp0131407 | Ga0110937
Sample NameWastewater microbial communities from the hospital sewers in Singapore - Hospital 1
Sequencing StatusPermanent Draft
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size144015912
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Microbial Communities From The Hospital Sewers
TypeEngineered
TaxonomyEngineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Hospital Sewers

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032312Metagenome / Metatranscriptome180N
F044555Metagenome / Metatranscriptome154N
F057196Metagenome / Metatranscriptome136Y
F080163Metagenome115N
F090333Metagenome / Metatranscriptome108Y
F094005Metagenome / Metatranscriptome106N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0110937_1012319All Organisms → Viruses → Predicted Viral1332Open in IMG/M
Ga0110937_1064172All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage885Open in IMG/M
Ga0110937_1069324All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae1287Open in IMG/M
Ga0110937_1089604Not Available534Open in IMG/M
Ga0110937_1157375All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii909Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0110937_1012319Ga0110937_10123192F094005MKKEVIKLKEGNSVIYQDKTLMEKANVVSIDKKNGTAILSNKVIITRTTNLEGQFTRLDGKGNAIILPCTTENEQKYNAFVAYHQSKKSLEAIKKWLDDNGKHKDDETLEKVITLDKKLKKLIEKLHE*
Ga0110937_1012319Ga0110937_10123193F032312MPKIKDYDEDLSAPKLLRERARDSKGRFIKKDLPPYLGAEQVLKPKNYYHFDSHGNYKGSSMNFDAMVCLGFTWFKLLVVALMMLLWPIVFIYALNDGIEGYPFKKYAIPYIFILVAWFIIFLYGLVS*
Ga0110937_1064172Ga0110937_10641721F090333VPLDVMKAYFEQPSVNRYIANQQNYNLGNVVTEHYTKGKAEPAYYMQAGDDFYLISKTDPLKLTQVHNVPTLSGFGDFKVRVSTRSEFYEVQAEIKITKMPNSQFSLKPGTKKKNPFMV*
Ga0110937_1069324Ga0110937_10693242F080163MKTIKFLQESFETKEKFQQEISFKYSYNRYTVESIDFRINQRNIRYFYEAMQNFENSLVDEFKEKKTNFCNAKQFLESINDFDKIIFVIITYMKTYFDFCKDYSKISLHVHLVQFDFTTSILIQGFYNYSHRDLSFSTKLESQVLDSENELLQEKLDLIREEICELIGVDPNLEKQGHEDNYVFNLNIESDNQIGFFLQATEL*
Ga0110937_1089604Ga0110937_10896041F057196MTQNTLCKDKSQLRAETEDAVQKFLKAGGTIQVVKARKAPKQKMRAIGTRQVSTGSTGFATGYPRRSTFIAN*
Ga0110937_1157375Ga0110937_11573753F044555MKTTNPSSRITISQNGNQILSCKVYKEPNYILSMSNEEILELISGLDYIGNLPTVPDLGKPIEIQVSTTRQIPLEQNKEVQTKIKEIIYNNLYDTLIDELKNTISRFQAQYNIQEINPYLQDILQNPEDLVSLTQHH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.