NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008385

3300008385: Human stool microbial communities from NIH, USA - visit number 3 of subject 763536994 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008385 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053205 | Ga0114873
Sample NameHuman stool microbial communities from NIH, USA - visit number 3 of subject 763536994 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size71645908
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073656Metagenome120N
F076064Metagenome118N
F089054Metagenome109N
F090514Metagenome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0114873_100139Not Available79209Open in IMG/M
Ga0114873_100397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii34349Open in IMG/M
Ga0114873_103672All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1991Open in IMG/M
Ga0114873_107194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii1082Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0114873_100139Ga0114873_10013949F089054MLTKGKFLVSFEVPGPLPGTTEGFCEEMVIPYRTEELRPYLRYPNQEINNNHLHSEHIRLQIREMLQIPLRDITIIDIISLP*
Ga0114873_100397Ga0114873_10039730F076064LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLAEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0114873_103672Ga0114873_1036722F073656MTMEQDQEQMQGALYVAVDDGNKIIAMERSRRSDEGFRALLDEFTDYAANCGAIPSVLFFDIRTTDAALLPRIEAAEHNYLLDPSTVTEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVAREDLRRCRAVETERGTVLFTQEPDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWTFVNPQHGENLYVSNGIRDLTGLQIIMQRGYGYLMQNAERYWNREFVFRSGFDNIERKYASDLSDEGRAAKREEQYNLAAYILDRKFPIRRRPSSEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGAEFHLKRH*
Ga0114873_107194Ga0114873_1071942F090514MNLRIHALKKASRQRPGLTIAAARFFSILYYPFCAKRSSFFQQNVQPRGNFFANRPIFVYFADVLPRLTGANWFVILLTIVPAGSRTRAGSSLPLIPASNIFLKQTPRRSLPLA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.