NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008350

3300008350: Human stool microbial communities from NIH, USA - visit 2, subject 370425937 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008350 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053297 | Ga0115414
Sample NameHuman stool microbial communities from NIH, USA - visit 2, subject 370425937 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size54671836
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029444Metagenome188Y
F101356Metagenome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0115414_100310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae38362Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0115414_100310Ga0115414_10031034F029444MKVSEQLTGFELEDLMSWTVSNLQRPFREDFSLEKSGIIAEKESQIFGRRFVGFDGPKKAAPFFNF*
Ga0115414_106055Ga0115414_1060552F101356VVGDITFRPHNETIDVGELIPVVTPEKDGLSNSKFATTKIKSEGKRSVLLYRSSSSQWAPFAIRVSCISTGEPLSDFCVYIAGNTMELQDSTKVYVKYLYGQPNSDTYLKMKYETDHRISIYLTSDKSLGDRTIVRELIVRDSMYDMATQDDEITGLADCTIVQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.