x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300008338
3300008338: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 763860675 reassembly
Overview
Basic Information
IMG/M Taxon OID 3300008338 Open in IMG/M GOLD Reference Gs0063646 | Gp0053212 | Ga0114891 Sample Name Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 763860675 reassembly Sequencing Status Permanent Draft Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis Published? N Use Policy Open
Dataset Contents
Total Genome Size 7067196 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes 1 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location National Institutes of Health, USA Coordinates Lat. (o ) N/A Long. (o ) N/A Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F051214 Metagenome 144 N F077781 Metagenome / Metatranscriptome 117 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0114891_100028 All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes 18780 Open in IMG/M Ga0114891_101395 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan 599 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0114891_100028 Ga0114891_10002824 F051214 LYPINLGYRLFLEKGAHMPGKIVAHDTHLRIDTEFIELKDCFEAFRRGVEYREKNDVDDILVICNAPDIIEYQLKNGDSFIVTYDPIHRIIVMRVFLHDEDITIKPIYIYNNREYQIACEFLRQVMHDKIDLKDEWIA* Ga0114891_101395 Ga0114891_1013951 F077781 PARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRPADSLYLGFPRPHPGTPGLGRFWPFLALQSLSETPSHARMPRVTVARTSPGTLEISPLRAAT*
