NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008307

3300008307: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765074482 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008307 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053236 | Ga0115186
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 765074482 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size32508817
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctSdk101

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027205Metagenome195N
F085821Metagenome111N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0115186_102142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga2131Open in IMG/M
Ga0115186_115451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctSdk10580Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0115186_102142Ga0115186_1021422F085821MDHIFEQLAPLAETKKQQTTVAKFIEKGFKFTRQPDAQKFTFLVYDFFIAGNMPAVQLCIDYLVAQGYPTAENKKQFLNWIFMEPVYYLKYFISDASTQKKLHHDLLNLWYESSKRQLLEQDKGKHDEAYIDAWNEASVNKTLSIIRSGETIASGKEDVVELAESLNDEYELNISLLDEYCRALLYTAETTQSQQELVAETQSHIALLKDLYKKVNKIK*
Ga0115186_115451Ga0115186_1154511F027205VASRLIVSADDILKAVKESEEFEKKALSEARKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKTPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEKDLFAFMDYLLDEYDIPRRIRK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.