3300008280: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160582958 reassembly

Overview

Basic Information

• IMG/M Taxon OID: 3300008280
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0053136 | Ga0114267
• Sample Name: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160582958 reassembly
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 77224037
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	1
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054110	Metagenome	140	N
F105378	Metagenome	100	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0114267_100005	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	229898
Ga0114267_109534	All Organisms → Viruses → Predicted Viral	1373

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0114267_100005	Ga0114267_100005199	F105378	MKVSVYVDKLKKWVPISSDEVLDRNKNLSDVKDKDAAITNLGLYDKFISKEALQSGFLPDVFTPENIVTDADHQFVSDSDKNNWNNKLNKPVEMQTNLEENQIGYDEVNEKFYIGLNNKNVLVGGASALDNIKIVNGFFSGNSQPTIIRNTKTKEDGTLISPIFVDVQCVEYTGGDLGEVSVSYTSELINIYNTGSFTGAFQCMIVYPLGSVNR*
Ga0114267_109534	Ga0114267_1095343	F054110	RYCVVLNVNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGD*