x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300008057
3300008057: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765560005 reassembly
Overview
Basic Information
IMG/M Taxon OID 3300008057 Open in IMG/M
GOLD Reference (Study | Sequencing Project | Analysis Project) Gs0063646 | Gp0053084 | Ga0114096
Sample Name Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765560005 reassembly
Sequencing Status Permanent Draft
Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published? N
Use Policy Open
Dataset Contents
Total Genome Size 21080922
Sequencing Scaffolds 2
Novel Protein Genes 2
Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus 1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip2 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Type Host-Associated
Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location USA: Maryland: Natonal Institute of Health
Coordinates Lat. (o ) 39.0042816 Long. (o ) -77.1012173 Alt. (m) N/A Depth (m) N/A
Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F097527 Metagenome 104 N F105380 Metagenome 100 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0114096_102455 All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus 1408 Open in IMG/M Ga0114096_104594 All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip2 856 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0114096_102455 Ga0114096_1024551 F097527 MIYFKMEKIGNSTHNKEKKTRSENLVFNTIPAAGVDPHHSPI Ga0114096_104594 Ga0114096_1045941 F105380 MEGRQTQYNINLADLDDQISDGIVYADRSGKMIYKFGAKKIIQTAITKDLTITVLDDEFKMDYYSFWVPDIYLISFKSFNPDGGLYLAYHKKDEKHICLTNIWPDSRNQDDTYFPNGKRLETKSICTGRMMDDIDSAEYSAWKNDPVTRASQYINKFINARGNADLDFVNSTLRRKVPNHNTKKFAEFLGS