| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007995 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052936 | Ga0111049 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160380657 reassembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 43033307 |
| Sequencing Scaffolds | 7 |
| Novel Protein Genes | 7 |
| Associated Families | 7 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 2 |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78 | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020492 | Metagenome | 223 | Y |
| F027205 | Metagenome | 195 | N |
| F035626 | Metagenome / Metatranscriptome | 171 | Y |
| F071329 | Metagenome | 122 | N |
| F081455 | Metagenome | 114 | N |
| F097527 | Metagenome | 104 | N |
| F103436 | Metagenome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0111049_101612 | All Organisms → Viruses → Predicted Viral | 3022 | Open in IMG/M |
| Ga0111049_104248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1567 | Open in IMG/M |
| Ga0111049_105126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 1375 | Open in IMG/M |
| Ga0111049_110674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 793 | Open in IMG/M |
| Ga0111049_112447 | Not Available | 707 | Open in IMG/M |
| Ga0111049_117465 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78 | 545 | Open in IMG/M |
| Ga0111049_119027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0111049_101612 | Ga0111049_1016123 | F071329 | MRPLYSKGILMLPVAKIIISGLSSIGAGMIASKLTKPIVSNANGIAKILLWFGSVGTGVAASAIVAREVELQFDATVKAVQEARDHVEIED* |
| Ga0111049_104248 | Ga0111049_1042484 | F027205 | VASRLIVSADDILKAVKESEAFERKALSEARKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKNPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEKDLFAFMDYILDEYDIPRRIKRSTK* |
| Ga0111049_105126 | Ga0111049_1051261 | F097527 | MEKIGNSTKTEKKKTRSENLVFITIPAAGVEPARPCGHWILSPAR |
| Ga0111049_110674 | Ga0111049_1106742 | F103436 | MSNKGWRDKTDSEIFDSLGDWVMKCDLKYSKSDALYKVKLAQCLWGDDKYVEAVHLLDENEVFFEKSDWSYYALGIEILKARKHKFFDE* |
| Ga0111049_112447 | Ga0111049_1124471 | F081455 | VNESLLELEKDYSPVEEIGMQNVEIIDSAEEAIQQPLANTDSSIAVNFSQMINKPETEEVKTELVSTPDNGEAKVNVVFPKNEHILGNYVDYDSFNKIKESNTDKVVRAVRLLNYKMADQNAAMKFGQFVSEFNSECDPSKRLRYELIRHQGREKDLVVRLSTVINGTTKYYADIYPDLNKIDVDHHLISSARK* |
| Ga0111049_117465 | Ga0111049_1174651 | F035626 | MASSIHNNAVQGETFLPGQIFVFGGFALRANSLGHLEQIEIYAPGRQVRFGSLNFTADIRGDLILDGFEPQPSVPHYRGEHDLALQPDSTLEAVLETTPIFNSGPAPQIEDGCLDTASGAAISVTIELNTIPVLCKARNS |
| Ga0111049_119027 | Ga0111049_1190271 | F020492 | MGLQAALLTSVALTAEVGALKQDPERSERELDLAKKQLEDKEGE* |
| ⦗Top⦘ |