NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007990

3300007990: Human stool microbial communities from NIH, USA - visit 1, subject 159915365 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007990 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052904 | Ga0105971
Sample NameHuman stool microbial communities from NIH, USA - visit 1, subject 159915365 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size18275282
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089592Metagenome109N
F102167Metagenome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105971_102973Not Available1261Open in IMG/M
Ga0105971_104777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium675Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105971_102973Ga0105971_1029731F089592KAPFPENATHVCCPWDDFSKAYNTGFYPRSRCYNGLDKNEIDRLVKQRVDNIMKPFEEMSQMDLSQTNLEFWDDAKDKIFMGKVYNTANTVDLFYLYLAVFSGMLTPQEMDGDPVFMNSMFCFVEKDNMKDFVQQREINKMNISYKFISALKKGGDDRQAVIDLLLYIGIVTRPDFTEDEYYTGSLSNWMNEKKTNVDYLLDIWDRSLEGDFKEVLEFYRIVNVLQRNGRITGHDVRTSAEFLATKKDFINIKANVLDEYEEIISMSNIDDKSKTKKVKDIKKKDDVEEGDKVKEE*
Ga0105971_104777Ga0105971_1047771F102167MDINQIKTYLPSGWDVVDLIDHGIIDLDIMNGKMIGEYVAVLMIKSYDRITESHNLTSFSFHDKDMVGLRRLVSNAIMAVGLRNNTLKGDGNTAIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.