3300007825: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764305738 replicate 2 reassembly

Overview

Basic Information

• IMG/M Taxon OID: 3300007825
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052883 | Ga0105914
• Sample Name: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764305738 replicate 2 reassembly
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 38176663
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077781	Metagenome / Metatranscriptome	117	N
F081456	Metagenome	114	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0105914_111665	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	582
Ga0105914_111690	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan	582

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0105914_111665	Ga0105914_1116652	F081456	MFEEPPIYYILISLIFLIVFFAISFATWMVWLTAISFFAKLVVTAIGFLLAAMTVILYTISAE*
Ga0105914_111690	Ga0105914_1116901	F077781	PARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGCPRPHPGTPGLGRFWLFLALQSLSETPSHARMPRVTVARTSPETVEISPLRAAT*