NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007825

3300007825: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764305738 replicate 2 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007825 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052883 | Ga0105914
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 764305738 replicate 2 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size38176663
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077781Metagenome / Metatranscriptome117N
F081456Metagenome114N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105914_111665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes582Open in IMG/M
Ga0105914_111690All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan582Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105914_111665Ga0105914_1116652F081456MFEEPPIYYILISLIFLIVFFAISFATWMVWLTAISFFAKLVVTAIGFLLAAMTVILYTISAE*
Ga0105914_111690Ga0105914_1116901F077781PARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGCPRPHPGTPGLGRFWLFLALQSLSETPSHARMPRVTVARTSPETVEISPLRAAT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.