NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007782

3300007782: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159591683 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007782 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052868 | Ga0105808
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 159591683 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size39149840
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip21

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077404Metagenome117N
F105380Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105808_100117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales30151Open in IMG/M
Ga0105808_100286All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip211621Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105808_100117Ga0105808_10011721F077404MAQQIILTHKLAAAALSLKEPTQIGNTKNPFAMNILKTAFAFFFALCFMMGANSYAQTTVRINAEASKRELKKNAVYLPPALEEYADTILLHQRFIVENKGNYLYTPFTKDNEPSIPFNYGFLHPLGERFYNSFMGKVDRILRPKEDKGFIILTNYLVVLDDKYAFDTSNKDTSKLADLKYLDFRRIKSDFSYGHPYQGFTDYDRVELSYFESYGRQAALETANTWVMASYPFSLQSTKFENLYTRGRKLILTDGKTTLSLYFLMIDSVALNFDTKVLPYIKGVFRFNRIR*
Ga0105808_100286Ga0105808_1002862F105380MSILQLDASQYVKQGRIFKKFDSNLLDSYMDGRQNNYNINLAELDDQISDGIVYADRNGKMIYKFGAKKIIQTAITNGLEISGLSKDLEMKHYSFWVPDLYFVSFYSFNPNEDLYIAYRSKDEEFICLTNIWPDGSSYAEDYFPNGDRLTLKRLCKGSMMSDVSSSDYDAWRNNAVTRASQFVNKFVSARGNSDLDFVGSALRSKVPSHNIKKCAVFLGTITKEQENVNTYEEFMEWTKNTKWFK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.