3300007773: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 763982056 reassembly

Overview

Basic Information

• IMG/M Taxon OID: 3300007773
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052853 | Ga0105763
• Sample Name: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 763982056 reassembly
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 24312456
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → unclassified Streptococcus → Streptococcus sp. C150	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097527	Metagenome	104	N
F103435	Metagenome	101	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0105763_100250	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → unclassified Streptococcus → Streptococcus sp. C150	5393

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0105763_100250	Ga0105763_1002508	F097527	MIYFKMEKIGNSTYNKEKKTRSENLVFITIPAAGERSPTAL
Ga0105763_109939	Ga0105763_1099391	F103435	FVAELTARDYPRNPWNYVSQLISKLTYQYLIDSPDFETIFSEVLFNQSEVEFYEFYKAIFRFYNGSEVFIIVSNNEYSDMVTQMMYNVIRRTYGIHPQIIYDMDDVYNIRDDIDFSPQGAQLAYLQRAEYLKLEAKRGFEPLQIWYPFDMNTYTNALE*