3300007575: Iron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_C_top_diel_T=7 metaT (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300007575
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0067861 | Gp0123762 | Ga0099844
• Sample Name: Iron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_C_top_diel_T=7 metaT (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 15189778
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: USA: Yellowstone National Park, Wyoming
• Coordinates
  • Lat. (^o): 44.7219
  • Long. (^o): -110.7021
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053392	Metagenome / Metatranscriptome	141	N
F094112	Metagenome / Metatranscriptome	106	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0099844_110210	Not Available	933
Ga0099844_134465	Not Available	725

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0099844_110210	Ga0099844_1102101	F053392	VRRMSVPSYVTLTGPQTTVMPASFTIAASALAGTVVQGSILAFGPQSPAVAAPQVPITEVWSIVDLYIIGTVTPDALLSIYINGYPQDINPDLNSLNLNNLTRWKLMQALKLPPASTWFTTITLLGANGTSQQTYTVYFSVIRAPYLPSA
Ga0099844_134465	Ga0099844_1344652	F094112	MSQSNIAVYNRGYNTITITNPTTGKTSVNLGLTTYNYPILAIHIYIYNTSSPASGYVKAVITPLDELVTGYTGYSPTIEYLIDAYKGAMYIPLAPHEYVNITISISAGANLEYDAILYDWMGEN*