3300007486: Iron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_B_top_diel_T=5 metaT (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300007486
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0067861 | Gp0123759 | Ga0099841
• Sample Name: Iron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_B_top_diel_T=5 metaT (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 12456746
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: USA: Yellowstone National Park, Wyoming
• Coordinates
  • Lat. (^o): 44.7219
  • Long. (^o): -110.7021
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003497	Metagenome / Metatranscriptome	483	Y
F053392	Metagenome / Metatranscriptome	141	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0099841_130348	Not Available	521
Ga0099841_130814	Not Available	638

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0099841_130348	Ga0099841_1303481	F003497	SNSPLPDRHARSKHGSQRSGDAALLLPVTAFIRLRISAPELIRHFYLLEAFVSERPFARPQRLFSFENHRGEVKAPDLFLRRNSELFFQPVRPCAPTLDDVYHATGDVRRTKPVAVSRAQNSQTSIQLSLPFRTFVPPDRSAQSAARSEKLTLVSGPFFLRSPKASITF*
Ga0099841_130814	Ga0099841_1308141	F053392	MVYARTRSITEVRRMSVPSYVTLTGPQTTVMPASFTIAASALAGTVVQGSILAFGPQSPAVAAPQVPITEVWSVIDLYIIGTVTPDALLSIYINGYPQDINPDLNSLNLNNLTRWKLMQALKLPPASTWFTTITLLGANGTSQQTYTVYFSVIRAPYLPSASSK*