NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007306

3300007306: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764892411 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007306 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052727 | Ga0104942
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 2, subject 764892411 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size39732829
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus1
All Organisms → Viruses → Predicted Viral1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ctYA4161

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080166Metagenome115N
F081455Metagenome114N
F097527Metagenome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0104942_105246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus1376Open in IMG/M
Ga0104942_108019All Organisms → Viruses → Predicted Viral1008Open in IMG/M
Ga0104942_119111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ctYA416511Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0104942_105246Ga0104942_1052463F097527MIYFKMEKIGNSTYNKEKKTRSENLVFNTIPAAGV
Ga0104942_108019Ga0104942_1080191F081455METTVNKNIMVNEDTTAFDDFITYALTRKLPEGYDIPPVEEIGMQNVEIIDSAEEAIQQPLANTDSSIAVNFSQMINKPEEVKTELVSTPDNGEAKVNVVFPKTEHILGNYVDYDSFNKIKESNTDKVVRAVRLLNYKMADQNAAMKFGQFVSEFNPNGDPNKRLRYELIRHQGREKDLVVRLSTVINGTTKYYADIYPDLNKIDIDHHLISSARK*
Ga0104942_119111Ga0104942_1191111F080166VVGANKLTANLRYKYRMRLSPRGETVGIIIDWDNYDDLCNIIDEAIDICDPNNKTSPFKRMYSTAGDLLDIKCDSLKVRYLHLEDRFGNRLDLMPFVLIDDHNGTLTEAMKFRFNNDLIFDVPVSRLKGFRRFLMTYNPLLHAGSMARYMAITPLLGNNRQNMMR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.