| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007306 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052727 | Ga0104942 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764892411 reassembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 39732829 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 1 |
| All Organisms → Viruses → Predicted Viral | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ctYA416 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080166 | Metagenome | 115 | N |
| F081455 | Metagenome | 114 | N |
| F097527 | Metagenome | 104 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0104942_105246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 1376 | Open in IMG/M |
| Ga0104942_108019 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| Ga0104942_119111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ctYA416 | 511 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0104942_105246 | Ga0104942_1052463 | F097527 | MIYFKMEKIGNSTYNKEKKTRSENLVFNTIPAAGV |
| Ga0104942_108019 | Ga0104942_1080191 | F081455 | METTVNKNIMVNEDTTAFDDFITYALTRKLPEGYDIPPVEEIGMQNVEIIDSAEEAIQQPLANTDSSIAVNFSQMINKPEEVKTELVSTPDNGEAKVNVVFPKTEHILGNYVDYDSFNKIKESNTDKVVRAVRLLNYKMADQNAAMKFGQFVSEFNPNGDPNKRLRYELIRHQGREKDLVVRLSTVINGTTKYYADIYPDLNKIDIDHHLISSARK* |
| Ga0104942_119111 | Ga0104942_1191111 | F080166 | VVGANKLTANLRYKYRMRLSPRGETVGIIIDWDNYDDLCNIIDEAIDICDPNNKTSPFKRMYSTAGDLLDIKCDSLKVRYLHLEDRFGNRLDLMPFVLIDDHNGTLTEAMKFRFNNDLIFDVPVSRLKGFRRFLMTYNPLLHAGSMARYMAITPLLGNNRQNMMR* |
| ⦗Top⦘ |